General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C5H1A2",
        "id": "C5H1A2_IMACE",
        "source_organism": {
            "taxId": "121343",
            "scientificName": "Imantodes cenchoa",
            "fullName": "Imantodes cenchoa (Blunt-headed tree snake)"
        },
        "name": "mRNA decay activator protein ZFP36",
        "description": [
            "Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis. Acts as a 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery. Functions by recruiting the CCR4-NOT deadenylase complex and probably other components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs, and hence promotes ARE-mediated mRNA deadenylation and decay processes. Binds to 3'-UTR ARE of numerous mRNAs"
        ],
        "length": 202,
        "sequence": "TCKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRAVAGGGREPVIAERPRLQHSFSFAGFPSAIAANGLLDSPTSITPPPIISDDLLGSPTLPDCASNPFTFSSQELTNLFAPSMGMQVPGGGSPTAFLLRPMSESPNMFDSPPSPQGSLSDQEGYLSSSSSSHSGSDSPILDTSRRLPI",
        "proteome": null,
        "gene": "ZFP36L1",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003729",
                "name": "mRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2d07578e935b1cfff44cc1653ceafa437332d212",
        "counters": {
            "domain_architectures": 7288,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7288
        }
    }
}