"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C5H1A2"	"{'domain_architectures': 7288, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'cathgene3d': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 7288}"	"[""Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis. Acts as a 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery. Functions by recruiting the CCR4-NOT deadenylase complex and probably other components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs, and hence promotes ARE-mediated mRNA deadenylation and decay processes. Binds to 3'-UTR ARE of numerous mRNAs""]"	"ZFP36L1"	"[{'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003729', 'name': 'mRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C5H1A2_IMACE"	"2d07578e935b1cfff44cc1653ceafa437332d212"	True	False	True	202	"mRNA decay activator protein ZFP36"	4	""	"TCKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRAVAGGGREPVIAERPRLQHSFSFAGFPSAIAANGLLDSPTSITPPPIISDDLLGSPTLPDCASNPFTFSSQELTNLFAPSMGMQVPGGGSPTAFLLRPMSESPNMFDSPPSPQGSLSDQEGYLSSSSSSHSGSDSPILDTSRRLPI"	"unreviewed"	"{'taxId': '121343', 'scientificName': 'Imantodes cenchoa', 'fullName': 'Imantodes cenchoa (Blunt-headed tree snake)'}"