General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C5A4H9",
        "id": "SECG_THEGJ",
        "source_organism": {
            "taxId": "593117",
            "scientificName": "Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)",
            "fullName": "Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)"
        },
        "name": "Preprotein translocase subunit SecG",
        "description": [
            "Involved in protein export. The function of the beta subunit is unknown, but it may be involved in stabilization of the trimeric complex"
        ],
        "length": 56,
        "sequence": "MAKDKTTLPPTGAGLMRFFDEDTRAIKVSPKGVIAIVLVLIAFEVFLHLFGPSIFG",
        "proteome": "UP000001488",
        "gene": "secG",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c2d69841fb38869543a543c43fb8cffe971b5be1",
        "counters": {
            "domain_architectures": 5456,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5456
        }
    }
}