"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C5A4H9"	"{'domain_architectures': 5456, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5456}"	"['Involved in protein export. The function of the beta subunit is unknown, but it may be involved in stabilization of the trimeric complex']"	"secG"	""	"SECG_THEGJ"	"c2d69841fb38869543a543c43fb8cffe971b5be1"	True	False	False	56	"Preprotein translocase subunit SecG"	3	"UP000001488"	"MAKDKTTLPPTGAGLMRFFDEDTRAIKVSPKGVIAIVLVLIAFEVFLHLFGPSIFG"	"reviewed"	"{'taxId': '593117', 'scientificName': 'Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)', 'fullName': 'Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)'}"