General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4M3N6",
        "id": "C4M3N6_ENTH1",
        "source_organism": {
            "taxId": "294381",
            "scientificName": "Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)",
            "fullName": "Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)"
        },
        "name": "F-actin-capping protein subunit alpha",
        "description": [
            "F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments"
        ],
        "length": 270,
        "sequence": "MASESEKTKIVTTFLKDSPPGEFNNVLKDCREVVGDDSIFQECLPICLHDYNTEQLTVVMDGTNPVIISKYTEQSAQEFIDPVNKKVVTFDHLSKQITSSQPLSSGLPGNDSLRQALQKKLDNYAKEFYPKGAAIVMPKDNNTYTIIISAADLKVAQFSNGKWRSEWTISVGSKVTCEGRIRVQVHYFEDANIQMHTDTKKKVTCNGGSEDQIAQNVIKEIKNIEDTFHAELDKIFATLSDNCLKALRRQLPISRQKINWANWKGHKMMK",
        "proteome": "UP000001926",
        "gene": "EHI_140640",
        "go_terms": [
            {
                "identifier": "GO:0051016",
                "name": "barbed-end actin filament capping",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008290",
                "name": "F-actin capping protein complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff85381e43d61365e37cf09fabf43be10b65d3f9",
        "counters": {
            "domain_architectures": 6385,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6385
        }
    }
}