"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C4M3N6"	"{'domain_architectures': 6385, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'panther': 1, 'pfam': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6385}"	"['F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments']"	"EHI_140640"	"[{'identifier': 'GO:0051016', 'name': 'barbed-end actin filament capping', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008290', 'name': 'F-actin capping protein complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"C4M3N6_ENTH1"	"ff85381e43d61365e37cf09fabf43be10b65d3f9"	True	False	False	270	"F-actin-capping protein subunit alpha"	3	"UP000001926"	"MASESEKTKIVTTFLKDSPPGEFNNVLKDCREVVGDDSIFQECLPICLHDYNTEQLTVVMDGTNPVIISKYTEQSAQEFIDPVNKKVVTFDHLSKQITSSQPLSSGLPGNDSLRQALQKKLDNYAKEFYPKGAAIVMPKDNNTYTIIISAADLKVAQFSNGKWRSEWTISVGSKVTCEGRIRVQVHYFEDANIQMHTDTKKKVTCNGGSEDQIAQNVIKEIKNIEDTFHAELDKIFATLSDNCLKALRRQLPISRQKINWANWKGHKMMK"	"unreviewed"	"{'taxId': '294381', 'scientificName': 'Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)', 'fullName': 'Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)'}"
