General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4LG87",
        "id": "Y143_CORK4",
        "source_organism": {
            "taxId": "645127",
            "scientificName": "Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)",
            "fullName": "Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)"
        },
        "name": "Nucleoid-associated protein ckrop_0143",
        "description": [
            "Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection"
        ],
        "length": 100,
        "sequence": "MAEPDFNEIMAQAQQMQEELQRVQGEIAQSEISGSAGNGLVKVTMKGTGEVTNVTIDKSVVDPDDVDTLQDLVLGALQDANTALQSYAQEKMGPFSQALG",
        "proteome": "UP000001473",
        "gene": "ckrop_0143",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a1d105df1f44a0ec24fb5f7ecfa8115df2d4b842",
        "counters": {
            "domain_architectures": 30139,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30139
        }
    }
}