"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C4LG87"	"{'domain_architectures': 30139, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'pirsf': 1, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 30139}"	"['Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection']"	"ckrop_0143"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"Y143_CORK4"	"a1d105df1f44a0ec24fb5f7ecfa8115df2d4b842"	True	False	False	100	"Nucleoid-associated protein ckrop_0143"	3	"UP000001473"	"MAEPDFNEIMAQAQQMQEELQRVQGEIAQSEISGSAGNGLVKVTMKGTGEVTNVTIDKSVVDPDDVDTLQDLVLGALQDANTALQSYAQEKMGPFSQALG"	"reviewed"	"{'taxId': '645127', 'scientificName': 'Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)', 'fullName': 'Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)'}"
