General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4KIJ1",
        "id": "IF6_SACI6",
        "source_organism": {
            "taxId": "426118",
            "scientificName": "Saccharolobus islandicus (strain M.16.4 / Kamchatka #3)",
            "fullName": "Saccharolobus islandicus (strain M.16.4 / Kamchatka #3)"
        },
        "name": "Translation initiation factor 6",
        "description": [
            "Binds to the 50S ribosomal subunit and prevents its association with the 30S ribosomal subunit to form the 70S initiation complex"
        ],
        "length": 223,
        "sequence": "MNLQRLSIFGTDNIGVYIYTNNKYTVVPRGLDSETKENIVQILGTELIEAEISRSFLLGIFISGNDNGILLPKSTIDDEFRFLKENLRDCRVEVLNSKVTALGNTILTNNKAALIYPEFNDIEEKIIKETLGVEEIRRGKIAQMITVGSVGVVTNKGGLVHVDTSEKELKELEKLFGVKIDIGTVNFGSVFIRSGLVANDKGTLVGASTTGPEILRIQKALGE",
        "proteome": null,
        "gene": "eif6",
        "go_terms": [
            {
                "identifier": "GO:0043022",
                "name": "ribosome binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042256",
                "name": "cytosolic ribosome assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8ac6a9139847722d5bca3b370d2864e1f85d42cd",
        "counters": {
            "domain_architectures": 5823,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "ssf": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5823
        }
    }
}