"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C4KIJ1"	"{'domain_architectures': 5823, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'smart': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 2, 'pirsf': 1, 'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 5823}"	"['Binds to the 50S ribosomal subunit and prevents its association with the 30S ribosomal subunit to form the 70S initiation complex']"	"eif6"	"[{'identifier': 'GO:0043022', 'name': 'ribosome binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042256', 'name': 'cytosolic ribosome assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"IF6_SACI6"	"8ac6a9139847722d5bca3b370d2864e1f85d42cd"	True	False	False	223	"Translation initiation factor 6"	3	""	"MNLQRLSIFGTDNIGVYIYTNNKYTVVPRGLDSETKENIVQILGTELIEAEISRSFLLGIFISGNDNGILLPKSTIDDEFRFLKENLRDCRVEVLNSKVTALGNTILTNNKAALIYPEFNDIEEKIIKETLGVEEIRRGKIAQMITVGSVGVVTNKGGLVHVDTSEKELKELEKLFGVKIDIGTVNFGSVFIRSGLVANDKGTLVGASTTGPEILRIQKALGE"	"reviewed"	"{'taxId': '426118', 'scientificName': 'Saccharolobus islandicus (strain M.16.4 / Kamchatka #3)', 'fullName': 'Saccharolobus islandicus (strain M.16.4 / Kamchatka #3)'}"