GET /api/protein/UniProt/C3VUW1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C3VUW1",
"id": "C3VUW1_9CYAN",
"source_organism": {
"taxId": "641630",
"scientificName": "Sphaerospermopsis aphanizomenoides UADFA8",
"fullName": "Sphaerospermopsis aphanizomenoides UADFA8"
},
"name": "nitrogenase",
"description": [
"The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein"
],
"length": 98,
"sequence": "RLMLHSKAQTTVLHLAAERGAVEDLELHEVMLTGFRGVKCVESGGPEPGVGCAGRGIITAINFLEENGAYTDLDFVSYDVLGDVVCGGFAMPIREGKA",
"proteome": null,
"gene": "nifH",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "071df9b5c0283bbb9290ef29639d54eb5a20356f",
"counters": {
"domain_architectures": 24594,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 24594
}
}
}