"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C3VUW1"	"{'domain_architectures': 24594, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'prints': 1, 'prosite': 2, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 24594}"	"['The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein']"	"nifH"	"[{'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C3VUW1_9CYAN"	"071df9b5c0283bbb9290ef29639d54eb5a20356f"	True	False	True	98	"nitrogenase"	3	""	"RLMLHSKAQTTVLHLAAERGAVEDLELHEVMLTGFRGVKCVESGGPEPGVGCAGRGIITAINFLEENGAYTDLDFVSYDVLGDVVCGGFAMPIREGKA"	"unreviewed"	"{'taxId': '641630', 'scientificName': 'Sphaerospermopsis aphanizomenoides UADFA8', 'fullName': 'Sphaerospermopsis aphanizomenoides UADFA8'}"
