HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C3MSY1",
"id": "C3MSY1_SACI4",
"source_organism": {
"taxId": "427317",
"scientificName": "Saccharolobus islandicus (strain M.14.25 / Kamchatka #1)",
"fullName": "Saccharolobus islandicus (strain M.14.25 / Kamchatka #1)"
},
"name": "pyruvate synthase",
"description": null,
"length": 184,
"sequence": "MLEIRFHGRGGQGVVTASQLLAEAAGYENLYTSSFPIYGAERRGAEIEAYCRISENPIRVTSPVEEPDYLVVIDNSLLQISRNLFRGLKDTSTIILNSPSKPDLNWRTFHVNATKIATDLGLVKSGWPMVNVIILGALIRVMGVPKLSSLEQAIEEEFGGKIAELNIKGARLAYEQVGVEYVTA",
"proteome": null,
"gene": "M1425_2566",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016903",
"name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016625",
"name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "29fbddc08da1aa452e7151193ed1b99c9e09a163",
"counters": {
"domain_architectures": 9785,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9785
}
}
}