"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C3MSY1"	"{'domain_architectures': 9785, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9785}"	""	"M1425_2566"	"[{'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016903', 'name': 'oxidoreductase activity, acting on the aldehyde or oxo group of donors', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016625', 'name': 'oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C3MSY1_SACI4"	"29fbddc08da1aa452e7151193ed1b99c9e09a163"	True	False	False	184	"pyruvate synthase"	4	""	"MLEIRFHGRGGQGVVTASQLLAEAAGYENLYTSSFPIYGAERRGAEIEAYCRISENPIRVTSPVEEPDYLVVIDNSLLQISRNLFRGLKDTSTIILNSPSKPDLNWRTFHVNATKIATDLGLVKSGWPMVNVIILGALIRVMGVPKLSSLEQAIEEEFGGKIAELNIKGARLAYEQVGVEYVTA"	"unreviewed"	"{'taxId': '427317', 'scientificName': 'Saccharolobus islandicus (strain M.14.25 / Kamchatka #1)', 'fullName': 'Saccharolobus islandicus (strain M.14.25 / Kamchatka #1)'}"