General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C1BWE8",
        "id": "C1BWE8_ESOLU",
        "source_organism": {
            "taxId": "8010",
            "scientificName": "Esox lucius",
            "fullName": "Esox lucius (Northern pike)"
        },
        "name": "Dynein light chain roadblock",
        "description": [
            "Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules"
        ],
        "length": 100,
        "sequence": "MAEVEETLKRIQTHKGVIGTIVVNAEGIPIRTTLDNSATVQYAGLLHQLTMKARSTVRDIDPQNDLTFLRIRSKKHEIMAAPDKEYMLIVIQNPSEQPQD",
        "proteome": null,
        "gene": "DLRB2",
        "go_terms": [
            {
                "identifier": "GO:0007018",
                "name": "microtubule-based movement",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005868",
                "name": "cytoplasmic dynein complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3da18beb9bf52065460305891d4df7f1d629bfeb",
        "counters": {
            "domain_architectures": 27690,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27690
        }
    }
}