"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C1BWE8"	"{'domain_architectures': 27690, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 27690}"	"['Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules']"	"DLRB2"	"[{'identifier': 'GO:0007018', 'name': 'microtubule-based movement', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005868', 'name': 'cytoplasmic dynein complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"C1BWE8_ESOLU"	"3da18beb9bf52065460305891d4df7f1d629bfeb"	True	False	False	100	"Dynein light chain roadblock"	2	""	"MAEVEETLKRIQTHKGVIGTIVVNAEGIPIRTTLDNSATVQYAGLLHQLTMKARSTVRDIDPQNDLTFLRIRSKKHEIMAAPDKEYMLIVIQNPSEQPQD"	"unreviewed"	"{'taxId': '8010', 'scientificName': 'Esox lucius', 'fullName': 'Esox lucius (Northern pike)'}"