General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C0H785",
        "id": "C0H785_SALSA",
        "source_organism": {
            "taxId": "8030",
            "scientificName": "Salmo salar",
            "fullName": "Salmo salar (Atlantic salmon)"
        },
        "name": "Large ribosomal subunit protein eL22",
        "description": [
            "Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell"
        ],
        "length": 131,
        "sequence": "MAPIKQVVKKTKTGGKKKKQALKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSIERSKSKISVNSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTKESYELRYFQINQDEEEEEDED",
        "proteome": "UP001652741",
        "gene": "RL22",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0ce7b770fead8110df43e91c787fb2fc411977bc",
        "counters": {
            "domain_architectures": 7290,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7290
        }
    }
}