"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C0H785"	"{'domain_architectures': 7290, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7290}"	"['Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell']"	"RL22"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"C0H785_SALSA"	"0ce7b770fead8110df43e91c787fb2fc411977bc"	True	False	False	131	"Large ribosomal subunit protein eL22"	2	"UP001652741"	"MAPIKQVVKKTKTGGKKKKQALKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSIERSKSKISVNSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTKESYELRYFQINQDEEEEEDED"	"unreviewed"	"{'taxId': '8030', 'scientificName': 'Salmo salar', 'fullName': 'Salmo salar (Atlantic salmon)'}"