HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C0CNI6",
"id": "C0CNI6_BLAHS",
"source_organism": {
"taxId": "476272",
"scientificName": "Blautia hydrogenotrophica (strain DSM 10507 / JCM 14656 / S5a33)",
"fullName": "Blautia hydrogenotrophica (strain DSM 10507 / JCM 14656 / S5a33)"
},
"name": "RNA polymerase sigma factor SigS",
"description": [
"Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Sigma-S contributes to the protection against external stress, thus playing a role in cellular fitness and survival"
],
"length": 202,
"sequence": "MDGYAEFSDEELIEKLRDGQEDVADYLMEKYKELVRQKARAMYLIGGETDDLIQEGMIGLFKAVRDYQPDKAASFQTFARLCIDRQLYKAISGSNRQKHQPLNTYVSLSQETEGERQLRSLWEQNPEAIVIARENVEDLEKRIEECLSSFENQVLECYLRGKDYEQIAAELGRPKKSIDNALHRIRGKVKICMGTTNNKKEY",
"proteome": "UP000003100",
"gene": "RUMHYD_02427",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006352",
"name": "DNA-templated transcription initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016987",
"name": "sigma factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5d8afe3c153ef44ecd370364a859b0968938511e",
"counters": {
"domain_architectures": 21591,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"prosite": 2,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 21591
}
}
}