"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C0CNI6"	"{'domain_architectures': 21591, 'entries': 19, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'pfam': 1, 'ncbifam': 2, 'pirsf': 1, 'panther': 1, 'prosite': 2, 'interpro': 8}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 21591}"	"['Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Sigma-S contributes to the protection against external stress, thus playing a role in cellular fitness and survival']"	"RUMHYD_02427"	"[{'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006352', 'name': 'DNA-templated transcription initiation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016987', 'name': 'sigma factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C0CNI6_BLAHS"	"5d8afe3c153ef44ecd370364a859b0968938511e"	True	False	False	202	"RNA polymerase sigma factor SigS"	3	"UP000003100"	"MDGYAEFSDEELIEKLRDGQEDVADYLMEKYKELVRQKARAMYLIGGETDDLIQEGMIGLFKAVRDYQPDKAASFQTFARLCIDRQLYKAISGSNRQKHQPLNTYVSLSQETEGERQLRSLWEQNPEAIVIARENVEDLEKRIEECLSSFENQVLECYLRGKDYEQIAAELGRPKKSIDNALHRIRGKVKICMGTTNNKKEY"	"unreviewed"	"{'taxId': '476272', 'scientificName': 'Blautia hydrogenotrophica (strain DSM 10507 / JCM 14656 / S5a33)', 'fullName': 'Blautia hydrogenotrophica (strain DSM 10507 / JCM 14656 / S5a33)'}"