General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B9WN06",
        "id": "B9WN06_CANDC",
        "source_organism": {
            "taxId": "573826",
            "scientificName": "Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841)",
            "fullName": "Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)"
        },
        "name": "Endoplasmic reticulum lectin",
        "description": [
            "Lectin involved in the quality control of the secretory pathway. As a member of the endoplasmic reticulum-associated degradation lumenal (ERAD-L) surveillance system, targets misfolded endoplasmic reticulum lumenal glycoproteins for degradation"
        ],
        "length": 258,
        "sequence": "MNWISFAYLCFIVKSISGDLISQPLKNKVVFIDTTIANEIARSYLGSDSGNSTQDDYEILSIENGVNEGNITSYLCQLPRSKELKLPNHTPTMSTHELKSRAIDLISESFGEDNSCLYSFNLHANYWTIGYCHGANVIQFHENLDDFISGVHKPHSPDHVYTLGKFSHQTSPSEFEFDSHERTISQRLLGEICDLTGEPRTIDTVYRCDHKLEIAELTEIRTCQYELHINVPKLCSLQEFRRTNLEEGVLEILCTKIE",
        "proteome": "UP000002605",
        "gene": "Cd36_35085",
        "go_terms": [
            {
                "identifier": "GO:0030968",
                "name": "endoplasmic reticulum unfolded protein response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0036503",
                "name": "ERAD pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dcc8d10c08e0918019581acda7d632b21f320c77",
        "counters": {
            "domain_architectures": 5251,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5251
        }
    }
}