"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B9WN06"	"{'domain_architectures': 5251, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'panther': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5251}"	"['Lectin involved in the quality control of the secretory pathway. As a member of the endoplasmic reticulum-associated degradation lumenal (ERAD-L) surveillance system, targets misfolded endoplasmic reticulum lumenal glycoproteins for degradation']"	"Cd36_35085"	"[{'identifier': 'GO:0030968', 'name': 'endoplasmic reticulum unfolded protein response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0036503', 'name': 'ERAD pathway', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B9WN06_CANDC"	"dcc8d10c08e0918019581acda7d632b21f320c77"	True	False	False	258	"Endoplasmic reticulum lectin"	3	"UP000002605"	"MNWISFAYLCFIVKSISGDLISQPLKNKVVFIDTTIANEIARSYLGSDSGNSTQDDYEILSIENGVNEGNITSYLCQLPRSKELKLPNHTPTMSTHELKSRAIDLISESFGEDNSCLYSFNLHANYWTIGYCHGANVIQFHENLDDFISGVHKPHSPDHVYTLGKFSHQTSPSEFEFDSHERTISQRLLGEICDLTGEPRTIDTVYRCDHKLEIAELTEIRTCQYELHINVPKLCSLQEFRRTNLEEGVLEILCTKIE"	"unreviewed"	"{'taxId': '573826', 'scientificName': 'Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841)', 'fullName': 'Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)'}"