General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B9LUU4",
        "id": "PFDA_HALLT",
        "source_organism": {
            "taxId": "416348",
            "scientificName": "Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)",
            "fullName": "Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)"
        },
        "name": "Prefoldin subunit alpha",
        "description": [
            "Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding"
        ],
        "length": 152,
        "sequence": "MMGGGQQQLQQLSQELQALDEEIEALEVEIDDHREEQSDIDDAIEAIETLDSGSTVQVPLGGGAYVRAEVQDIDEIIVSLGGNYSAEQSEEDAIDVLGRKRDALDDRIEETQEEVDELESESQELEQQAQQMQQQMQQQQMQQMQQSQGDEE",
        "proteome": "UP000000740",
        "gene": "pfdA",
        "go_terms": [
            {
                "identifier": "GO:0051082",
                "name": "unfolded protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006457",
                "name": "protein folding",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016272",
                "name": "prefoldin complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bc0bdc5e1accc6ba61a70135255c8cbcb5257e7e",
        "counters": {
            "domain_architectures": 14091,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14091
        }
    }
}