"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B9LUU4"	"{'domain_architectures': 14091, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14091}"	"['Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding']"	"pfdA"	"[{'identifier': 'GO:0051082', 'name': 'unfolded protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006457', 'name': 'protein folding', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016272', 'name': 'prefoldin complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PFDA_HALLT"	"bc0bdc5e1accc6ba61a70135255c8cbcb5257e7e"	True	False	False	152	"Prefoldin subunit alpha"	3	"UP000000740"	"MMGGGQQQLQQLSQELQALDEEIEALEVEIDDHREEQSDIDDAIEAIETLDSGSTVQVPLGGGAYVRAEVQDIDEIIVSLGGNYSAEQSEEDAIDVLGRKRDALDDRIEETQEEVDELESESQELEQQAQQMQQQMQQQQMQQMQQSQGDEE"	"reviewed"	"{'taxId': '416348', 'scientificName': 'Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)', 'fullName': 'Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)'}"