HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B9IVQ9",
"id": "CCA_BACCQ",
"source_organism": {
"taxId": "361100",
"scientificName": "Bacillus cereus (strain Q1)",
"fullName": "Bacillus cereus (strain Q1)"
},
"name": "CCA-adding enzyme",
"description": [
"Catalyzes the addition and repair of the essential 3'-terminal CCA sequence in tRNAs without using a nucleic acid template. Adds these three nucleotides in the order of C, C, and A to the tRNA nucleotide-73, using CTP and ATP as substrates and producing inorganic pyrophosphate. tRNA 3'-terminal CCA addition is required both for tRNA processing and repair. Also involved in tRNA surveillance by mediating tandem CCA addition to generate a CCACCA at the 3' terminus of unstable tRNAs. While stable tRNAs receive only 3'-terminal CCA, unstable tRNAs are marked with CCACCA and rapidly degraded"
],
"length": 397,
"sequence": "MERFKKASSIIETLKQQGHEAYFVGGSVRDLIIDRPIGDIDIATSALPEEVMAIFPRHVPVGLEHGTVIVVENGEPYEVTTFRTESEYEDFRRPSSVQFVRSLEEDLKRRDFTMNAIAMTEEGKMVDLFAGQEAIQKREIMTVGNAADRFQEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERITVEFEKLLTGTYCVKALKELVETKLFSHLPYLQMSEEKLLKATQYKWDSFEADIEAWAFFLYCIGEEHPAVFLRQWKFSNKKIKDIVAVLLTIRKRKEKDWDTVLLYKTGIHIAEMAERVYEAMIESYDHTAVNRVQTLFQALPIKNRQEMNVTGNDLLNWASKKPGPWVAEMIQKIEEAIVQGNVVNEKECIREWLQECNLL",
"proteome": null,
"gene": "cca",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016779",
"name": "nucleotidyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006396",
"name": "RNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004810",
"name": "CCA tRNA nucleotidyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0001680",
"name": "tRNA 3'-terminal CCA addition",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "32cfc1308e1885dbe81b8f4fcc905da285e7a72e",
"counters": {
"domain_architectures": 5423,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 4,
"cdd": 1,
"ssf": 2,
"pfam": 3,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 5423
}
}
}