"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B9IVQ9"	"{'domain_architectures': 5423, 'entries': 19, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 4, 'cdd': 1, 'ssf': 2, 'pfam': 3, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 5423}"	"[""Catalyzes the addition and repair of the essential 3'-terminal CCA sequence in tRNAs without using a nucleic acid template. Adds these three nucleotides in the order of C, C, and A to the tRNA nucleotide-73, using CTP and ATP as substrates and producing inorganic pyrophosphate. tRNA 3'-terminal CCA addition is required both for tRNA processing and repair. Also involved in tRNA surveillance by mediating tandem CCA addition to generate a CCACCA at the 3' terminus of unstable tRNAs. While stable tRNAs receive only 3'-terminal CCA, unstable tRNAs are marked with CCACCA and rapidly degraded""]"	"cca"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016779', 'name': 'nucleotidyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006396', 'name': 'RNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0004810', 'name': 'CCA tRNA nucleotidyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0001680', 'name': ""tRNA 3'-terminal CCA addition"", 'category': {'code': 'P', 'name': 'biological_process'}}]"	"CCA_BACCQ"	"32cfc1308e1885dbe81b8f4fcc905da285e7a72e"	True	False	False	397	"CCA-adding enzyme"	3	""	"MERFKKASSIIETLKQQGHEAYFVGGSVRDLIIDRPIGDIDIATSALPEEVMAIFPRHVPVGLEHGTVIVVENGEPYEVTTFRTESEYEDFRRPSSVQFVRSLEEDLKRRDFTMNAIAMTEEGKMVDLFAGQEAIQKREIMTVGNAADRFQEDALRMMRGIRFVSTLGFSLETKTKQAIETYGHLLEHIAIERITVEFEKLLTGTYCVKALKELVETKLFSHLPYLQMSEEKLLKATQYKWDSFEADIEAWAFFLYCIGEEHPAVFLRQWKFSNKKIKDIVAVLLTIRKRKEKDWDTVLLYKTGIHIAEMAERVYEAMIESYDHTAVNRVQTLFQALPIKNRQEMNVTGNDLLNWASKKPGPWVAEMIQKIEEAIVQGNVVNEKECIREWLQECNLL"	"reviewed"	"{'taxId': '361100', 'scientificName': 'Bacillus cereus (strain Q1)', 'fullName': 'Bacillus cereus (strain Q1)'}"