GET /api/protein/UniProt/B8YJB4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B8YJB4",
"id": "B8YJB4_GALSO",
"source_organism": {
"taxId": "9033",
"scientificName": "Gallus sonneratii",
"fullName": "Gallus sonneratii (Grey junglefowl)"
},
"name": "Interferon gamma",
"description": [
"Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons"
],
"length": 164,
"sequence": "MTCQTYNLFVLSVIMIYYGHTASSLNLVQLQDDIDKLKADFXXXXXXXXXXXXIIVEKLKNWTERNEKRIILSQIVSMYLEMLENTDKSKPHIKHISEELYTLKNNLPDGMKKVKDIMDLAKLPMNDLRIQRKAANELFSILQKLVDPPSFKRKRSQSQRRCNC",
"proteome": null,
"gene": "IFNG",
"go_terms": [
{
"identifier": "GO:0005133",
"name": "type II interferon receptor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006955",
"name": "immune response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "2798299a8d8c9bff849c7af7ddc1a45471be0942",
"counters": {
"domain_architectures": 934,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 934
}
}
}