"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8YJB4"	"{'domain_architectures': 934, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 934}"	"['Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons']"	"IFNG"	"[{'identifier': 'GO:0005133', 'name': 'type II interferon receptor binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006955', 'name': 'immune response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B8YJB4_GALSO"	"2798299a8d8c9bff849c7af7ddc1a45471be0942"	False	False	False	164	"Interferon gamma"	3	""	"MTCQTYNLFVLSVIMIYYGHTASSLNLVQLQDDIDKLKADFXXXXXXXXXXXXIIVEKLKNWTERNEKRIILSQIVSMYLEMLENTDKSKPHIKHISEELYTLKNNLPDGMKKVKDIMDLAKLPMNDLRIQRKAANELFSILQKLVDPPSFKRKRSQSQRRCNC"	"unreviewed"	"{'taxId': '9033', 'scientificName': 'Gallus sonneratii', 'fullName': 'Gallus sonneratii (Grey junglefowl)'}"