General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8ND35",
        "id": "B8ND35_ASPFN",
        "source_organism": {
            "taxId": "332952",
            "scientificName": "Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)",
            "fullName": "Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)"
        },
        "name": "Formate dehydrogenase",
        "description": [
            "Catalyzes the NAD(+)-dependent oxidation of formate to carbon dioxide. Formate oxidation is the final step in the methanol oxidation pathway in methylotrophic microorganisms. Has a role in the detoxification of exogenous formate in non-methylotrophic organisms"
        ],
        "length": 365,
        "sequence": "MGKILMVLYDGGEHAKQQPGLLGTTENELGLRKWLEEQGHTLVTTSDKEGENSTFDKELVDAEVIITTPFHPGYLTAERLAKAKNLKIAVTAGVGSDHVDLNAANKTNGGITVAEVTGCNVTSVAEHVVMTILTLVRNFVPAHEQITRGEWDVAAVAKNEFDLEGKVVGTVAVGRIGERVLRRLKPFDCKELLYYDYQPLSPEVEKEIGCRRVDTLEEMLAQCDVVTINCPLHEKTRGLFNKDLISKMKKGSWLVNTARGAIVVKEDVAEAVKSGHLRGYGGDVWYPQPAPKDHPLRYVQGPWGGGNAMVPHMSGTSIDAQIRYAQGTKAILESYFSGRHDYKNEDLIVRGGDYVTKAYGQRNKA",
        "proteome": "UP000596276",
        "gene": "F9C07_6115",
        "go_terms": [
            {
                "identifier": "GO:0008863",
                "name": "formate dehydrogenase (NAD+) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e947ae83d5e04cc3fe2c0685a42589c00bed270d",
        "counters": {
            "domain_architectures": 31722,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 2,
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 3,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 31722
        }
    }
}