"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8ND35"	"{'domain_architectures': 31722, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 2, 'cathgene3d': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 3, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 31722}"	"['Catalyzes the NAD(+)-dependent oxidation of formate to carbon dioxide. Formate oxidation is the final step in the methanol oxidation pathway in methylotrophic microorganisms. Has a role in the detoxification of exogenous formate in non-methylotrophic organisms']"	"F9C07_6115"	"[{'identifier': 'GO:0008863', 'name': 'formate dehydrogenase (NAD+) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051287', 'name': 'NAD binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B8ND35_ASPFN"	"e947ae83d5e04cc3fe2c0685a42589c00bed270d"	True	False	False	365	"Formate dehydrogenase"	3	"UP000596276"	"MGKILMVLYDGGEHAKQQPGLLGTTENELGLRKWLEEQGHTLVTTSDKEGENSTFDKELVDAEVIITTPFHPGYLTAERLAKAKNLKIAVTAGVGSDHVDLNAANKTNGGITVAEVTGCNVTSVAEHVVMTILTLVRNFVPAHEQITRGEWDVAAVAKNEFDLEGKVVGTVAVGRIGERVLRRLKPFDCKELLYYDYQPLSPEVEKEIGCRRVDTLEEMLAQCDVVTINCPLHEKTRGLFNKDLISKMKKGSWLVNTARGAIVVKEDVAEAVKSGHLRGYGGDVWYPQPAPKDHPLRYVQGPWGGGNAMVPHMSGTSIDAQIRYAQGTKAILESYFSGRHDYKNEDLIVRGGDYVTKAYGQRNKA"	"unreviewed"	"{'taxId': '332952', 'scientificName': 'Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)', 'fullName': 'Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)'}"