General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8N7Z7",
        "id": "B8N7Z7_ASPFN",
        "source_organism": {
            "taxId": "332952",
            "scientificName": "Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)",
            "fullName": "Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)"
        },
        "name": "AA9 family lytic polysaccharide monooxygenase",
        "description": [
            "Lytic polysaccharide monooxygenase (LMPO) that depolymerizes crystalline and amorphous polysaccharides via the oxidation of scissile alpha- or beta-(1-4)-glycosidic bonds, yielding C1 and/or C4 oxidation products. Catalysis by LPMOs requires the reduction of the active-site copper from Cu(II) to Cu(I) by a reducing agent and H(2)O(2) or O(2) as a cosubstrate"
        ],
        "length": 283,
        "sequence": "MKLSFLALAAIAPFVSAHYFFDTLIVDGKESSPNQYVRSNTRPAKYNPTKWVNTRDDMTPDMPDFRCNKGSFTFAGQTGTAEVKAGSKLAMKLGVGATMKHPGPALVYMSKAPSTAKTYQGDGDWFKIYEEGICDKNKDVKSDAWCSYDKDRVEFTIPKDLADGEYLIRAEHIGVHGAHAGEAEFYYECAQVKVVGGGNGTPGPTVKFPGAYKKTDPSFTYSVWGGYKDYPMPGPQVWTGSSGSKHFSKVVDVNATGGTSSQGNAATFDGSFTRREHARDFTY",
        "proteome": "UP000596276",
        "gene": "F9C07_4327",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9c8166bb03870256d11d81add28bbd3a12af7833",
        "counters": {
            "domain_architectures": 14026,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14026
        }
    }
}