"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8N7Z7"	"{'domain_architectures': 14026, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14026}"	"['Lytic polysaccharide monooxygenase (LMPO) that depolymerizes crystalline and amorphous polysaccharides via the oxidation of scissile alpha- or beta-(1-4)-glycosidic bonds, yielding C1 and/or C4 oxidation products. Catalysis by LPMOs requires the reduction of the active-site copper from Cu(II) to Cu(I) by a reducing agent and H(2)O(2) or O(2) as a cosubstrate']"	"F9C07_4327"	""	"B8N7Z7_ASPFN"	"9c8166bb03870256d11d81add28bbd3a12af7833"	True	False	False	283	"AA9 family lytic polysaccharide monooxygenase"	4	"UP000596276"	"MKLSFLALAAIAPFVSAHYFFDTLIVDGKESSPNQYVRSNTRPAKYNPTKWVNTRDDMTPDMPDFRCNKGSFTFAGQTGTAEVKAGSKLAMKLGVGATMKHPGPALVYMSKAPSTAKTYQGDGDWFKIYEEGICDKNKDVKSDAWCSYDKDRVEFTIPKDLADGEYLIRAEHIGVHGAHAGEAEFYYECAQVKVVGGGNGTPGPTVKFPGAYKKTDPSFTYSVWGGYKDYPMPGPQVWTGSSGSKHFSKVVDVNATGGTSSQGNAATFDGSFTRREHARDFTY"	"unreviewed"	"{'taxId': '332952', 'scientificName': 'Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)', 'fullName': 'Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)'}"