GET /api/protein/UniProt/B8N2M0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8N2M0",
        "id": "B8N2M0_ASPFN",
        "source_organism": {
            "taxId": "332952",
            "scientificName": "Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)",
            "fullName": "Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)"
        },
        "name": "6,7-dimethyl-8-ribityllumazine synthase",
        "description": [
            "Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin"
        ],
        "length": 208,
        "sequence": "MASLKGPGATPSFDGSGLRIAIVHARWNMGIIGPLVEGARKSLLAAGVVEDHITTLTVPGSYELPYAAQRLYAASQLQAAKSSSSGEGISATDLLSSSTADISKASPESPTSATSRPFDAIIAIGVLIKGETMHFEYIADAVSHGLMRVQLDSGVPVIFGVLTVLTEEQGLERAGLGKKGMHNHGEDWGSAAVELGARRREWAEGRIA",
        "proteome": "UP000596276",
        "gene": "F9C07_3168",
        "go_terms": [
            {
                "identifier": "GO:0009231",
                "name": "riboflavin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009349",
                "name": "riboflavin synthase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0000906",
                "name": "6,7-dimethyl-8-ribityllumazine synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f45b79fec4d9c051c2581fd128d2a6508e1cb255",
        "counters": {
            "domain_architectures": 1258,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1258
        }
    }
}