"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8N2M0"	"{'domain_architectures': 1258, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1258}"	"['Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin']"	"F9C07_3168"	"[{'identifier': 'GO:0009231', 'name': 'riboflavin biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009349', 'name': 'riboflavin synthase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0000906', 'name': '6,7-dimethyl-8-ribityllumazine synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B8N2M0_ASPFN"	"f45b79fec4d9c051c2581fd128d2a6508e1cb255"	True	False	False	208	"6,7-dimethyl-8-ribityllumazine synthase"	3	"UP000596276"	"MASLKGPGATPSFDGSGLRIAIVHARWNMGIIGPLVEGARKSLLAAGVVEDHITTLTVPGSYELPYAAQRLYAASQLQAAKSSSSGEGISATDLLSSSTADISKASPESPTSATSRPFDAIIAIGVLIKGETMHFEYIADAVSHGLMRVQLDSGVPVIFGVLTVLTEEQGLERAGLGKKGMHNHGEDWGSAAVELGARRREWAEGRIA"	"unreviewed"	"{'taxId': '332952', 'scientificName': 'Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)', 'fullName': 'Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)'}"