General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8N0E6",
        "id": "ASAA_ASPFN",
        "source_organism": {
            "taxId": "332952",
            "scientificName": "Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)",
            "fullName": "Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)"
        },
        "name": "Ankyrin-repeat domain containing transcription coregulator asaA",
        "description": [
            "Transcription coregulator involved in regulation of gene cluster that mediates the biosynthesis of aspergillic acid, a hydroxamic acid-containing pyrazinone with aliphatic side chains that originates from leucine (Leu) and isoleucine (Ile) (PubMed:29674152). Aspergillic acid has antibiotic properties and was shown to be lethal to mice (PubMed:29674152)"
        ],
        "length": 338,
        "sequence": "MGAPHEEIQALKRRREQNRLAQRRRRDNVRRRLRDLGLDTGSPASASQTSLCSSTDSRVTLNPHQSLRSTDFLSFETSNSDTEMSPYDPPLQSKLRLDSQIPLAEISFPSYASSVSPSSSAGPLSSSPSPSQRPFIDSTDLTSLQSVYNPTSLAVHLDESSMPCGEAEIPTRQDSNFPRTPNLKSLMSGCNDPSAYQPWILTSSTVGEQMSSQALPHSPGPQHCSTPLPAETRPRWTTALHMAVSQGNFSVMRLLLSYGADPNAVNSEGATALHVGVMNGNYTMVAELLQRGADPTLTNAAGWLPLHQAVHAGDEGCVRVLLEADQPVDYPISDLDYT",
        "proteome": null,
        "gene": "asaA",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a2b245675e56d7c902b06d6a34c0b06f035c112",
        "counters": {
            "domain_architectures": 107062,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "profile": 2,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 107062
        }
    }
}