"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8N0E6"	"{'domain_architectures': 107062, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'smart': 1, 'profile': 2, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 107062}"	"['Transcription coregulator involved in regulation of gene cluster that mediates the biosynthesis of aspergillic acid, a hydroxamic acid-containing pyrazinone with aliphatic side chains that originates from leucine (Leu) and isoleucine (Ile) (PubMed:29674152). Aspergillic acid has antibiotic properties and was shown to be lethal to mice (PubMed:29674152)']"	"asaA"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"ASAA_ASPFN"	"6a2b245675e56d7c902b06d6a34c0b06f035c112"	True	False	False	338	"Ankyrin-repeat domain containing transcription coregulator asaA"	2	""	"MGAPHEEIQALKRRREQNRLAQRRRRDNVRRRLRDLGLDTGSPASASQTSLCSSTDSRVTLNPHQSLRSTDFLSFETSNSDTEMSPYDPPLQSKLRLDSQIPLAEISFPSYASSVSPSSSAGPLSSSPSPSQRPFIDSTDLTSLQSVYNPTSLAVHLDESSMPCGEAEIPTRQDSNFPRTPNLKSLMSGCNDPSAYQPWILTSSTVGEQMSSQALPHSPGPQHCSTPLPAETRPRWTTALHMAVSQGNFSVMRLLLSYGADPNAVNSEGATALHVGVMNGNYTMVAELLQRGADPTLTNAAGWLPLHQAVHAGDEGCVRVLLEADQPVDYPISDLDYT"	"reviewed"	"{'taxId': '332952', 'scientificName': 'Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)', 'fullName': 'Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)'}"
