General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8EJL7",
        "id": "AZOR_METSB",
        "source_organism": {
            "taxId": "395965",
            "scientificName": "Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)",
            "fullName": "Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)"
        },
        "name": "FMN-dependent NADH:quinone oxidoreductase",
        "description": [
            "Quinone reductase that provides resistance to thiol-specific stress caused by electrophilic quinones",
            "Also exhibits azoreductase activity. Catalyzes the reductive cleavage of the azo bond in aromatic azo compounds to the corresponding amines"
        ],
        "length": 204,
        "sequence": "MKLLHIDSSILGDHSVSRQLTAAIIARLQEVTPDLDVSHRDLAANPLSHLSGALLAASAPGAPAPDPSTQAALGESAAILAEFLAADIVVVGAPMYNFAISSQLKAWIDRLVIAGKTFRYADGAVEGLAGGRRLIIASSRGGVFEAGAAAAALDYQETYLRAIFGFIGIADVEIIRAEGLAFGEDARALAIKQAGDAILRLEAA",
        "proteome": "UP000002257",
        "gene": "azoR",
        "go_terms": [
            {
                "identifier": "GO:0010181",
                "name": "FMN binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016655",
                "name": "oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "effa34ee8b593b78910e0b60ae539ba4e533ff91",
        "counters": {
            "domain_architectures": 49058,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 49058
        }
    }
}