GET /api/protein/UniProt/B8EJL7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B8EJL7",
"id": "AZOR_METSB",
"source_organism": {
"taxId": "395965",
"scientificName": "Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)",
"fullName": "Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)"
},
"name": "FMN-dependent NADH:quinone oxidoreductase",
"description": [
"Quinone reductase that provides resistance to thiol-specific stress caused by electrophilic quinones",
"Also exhibits azoreductase activity. Catalyzes the reductive cleavage of the azo bond in aromatic azo compounds to the corresponding amines"
],
"length": 204,
"sequence": "MKLLHIDSSILGDHSVSRQLTAAIIARLQEVTPDLDVSHRDLAANPLSHLSGALLAASAPGAPAPDPSTQAALGESAAILAEFLAADIVVVGAPMYNFAISSQLKAWIDRLVIAGKTFRYADGAVEGLAGGRRLIIASSRGGVFEAGAAAAALDYQETYLRAIFGFIGIADVEIIRAEGLAFGEDARALAIKQAGDAILRLEAA",
"proteome": "UP000002257",
"gene": "azoR",
"go_terms": [
{
"identifier": "GO:0010181",
"name": "FMN binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016655",
"name": "oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "effa34ee8b593b78910e0b60ae539ba4e533ff91",
"counters": {
"domain_architectures": 49058,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 49058
}
}
}