"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8EJL7"	"{'domain_architectures': 49058, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 49058}"	"['Quinone reductase that provides resistance to thiol-specific stress caused by electrophilic quinones', 'Also exhibits azoreductase activity. Catalyzes the reductive cleavage of the azo bond in aromatic azo compounds to the corresponding amines']"	"azoR"	"[{'identifier': 'GO:0010181', 'name': 'FMN binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016655', 'name': 'oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"AZOR_METSB"	"effa34ee8b593b78910e0b60ae539ba4e533ff91"	True	False	False	204	"FMN-dependent NADH:quinone oxidoreductase"	3	"UP000002257"	"MKLLHIDSSILGDHSVSRQLTAAIIARLQEVTPDLDVSHRDLAANPLSHLSGALLAASAPGAPAPDPSTQAALGESAAILAEFLAADIVVVGAPMYNFAISSQLKAWIDRLVIAGKTFRYADGAVEGLAGGRRLIIASSRGGVFEAGAAAAALDYQETYLRAIFGFIGIADVEIIRAEGLAFGEDARALAIKQAGDAILRLEAA"	"reviewed"	"{'taxId': '395965', 'scientificName': 'Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)', 'fullName': 'Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)'}"