General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7UJE2",
        "id": "ECPR_ECO27",
        "source_organism": {
            "taxId": "574521",
            "scientificName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)",
            "fullName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)"
        },
        "name": "HTH-type transcriptional regulator EcpR",
        "description": [
            "Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition (By similarity). Positively regulates the expression of the ecp operon by binding to two TTCCT boxes"
        ],
        "length": 196,
        "sequence": "MTWQNDYSRDYEVKNHMECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKDFVFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLSRDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPKSIARIENCSVKTVYTHRRNAEAKLYSKLYKLVQ",
        "proteome": "UP000008205",
        "gene": "ecpR",
        "go_terms": [
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ea0d3f17cd351cee04b6d1cdc71ab9e36d078a9a",
        "counters": {
            "domain_architectures": 243,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 243
        }
    }
}