"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7UJE2"	"{'domain_architectures': 243, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'smart': 1, 'cdd': 1, 'ncbifam': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 243}"	"['Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition (By similarity). Positively regulates the expression of the ecp operon by binding to two TTCCT boxes']"	"ecpR"	"[{'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"ECPR_ECO27"	"ea0d3f17cd351cee04b6d1cdc71ab9e36d078a9a"	True	False	False	196	"HTH-type transcriptional regulator EcpR"	1	"UP000008205"	"MTWQNDYSRDYEVKNHMECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKDFVFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLSRDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPKSIARIENCSVKTVYTHRRNAEAKLYSKLYKLVQ"	"reviewed"	"{'taxId': '574521', 'scientificName': 'Escherichia coli O127:H6 (strain E2348/69 / EPEC)', 'fullName': 'Escherichia coli O127:H6 (strain E2348/69 / EPEC)'}"