General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7UI22",
        "id": "NLEE_ECO27",
        "source_organism": {
            "taxId": "574521",
            "scientificName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)",
            "fullName": "Escherichia coli O127:H6 (strain E2348/69 / EPEC)"
        },
        "name": "Cysteine S-methyltransferase NleE",
        "description": [
            "Cysteine methyltransferase effector that inhibits host cell NF-kappa-B activation by preventing nuclear translocation of host protein RELA/p65 (PubMed:20126447, PubMed:20485572, PubMed:22158122, PubMed:25412445, PubMed:27445336). Acts by mediating cysteine methylation of host proteins TAB2 and TAB3: methylation of a conserved cysteine residue of the RanBP2-type zinc finger (NZF) of TAB2 and TAB3 disrupts zinc-binding, thereby inactivating the ubiquitin chain-binding activity of TAB2 and TAB3, leading to NF-kappa-B inactivation (PubMed:22158122, PubMed:25412445, PubMed:27445336). Also mediates cysteine methylation of host protein ZRANB3, inactivating its ability to bind ubiquitin chains (PubMed:25412445)"
        ],
        "length": 224,
        "sequence": "MINPVTNTQGVSPINTKYAEHVVKNIYPKIKHDYFNESPNIYDKKYISGITRGVAELKQEEFVNEKARRFSYMKTMYSVCPEAFEPISRNEASTPEGSWLTVISGKRPMGQFSVDSLYNPDLHALCELPDICCKIFPKENNDFLYIVVVYRNDSPLGEQRANRFIELYNIKRDIMQELNYELPELKAVKSEMIIAREMGEIFSYMPGEIDSYMKYINNKLSKIE",
        "proteome": "UP000008205",
        "gene": "nleE",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7bda791a46a38a1689028b92b92384b330ae2758",
        "counters": {
            "domain_architectures": 96,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 96
        }
    }
}