GET /api/protein/UniProt/B7QKW9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7QKW9",
        "id": "B7QKW9_IXOSC",
        "source_organism": {
            "taxId": "6945",
            "scientificName": "Ixodes scapularis",
            "fullName": "Ixodes scapularis (Black-legged tick)"
        },
        "name": "26S proteasome complex subunit SEM1",
        "description": [
            "Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins"
        ],
        "length": 79,
        "sequence": "MADPNAKGKVDLGLLEEDDEFEEFPAEEWTAKGEDAQDINVWEDNWDDDNIEDDFSQQLRAELEKQGYKIDGTGEPIKS",
        "proteome": "UP000001555",
        "gene": "8042785",
        "go_terms": [
            {
                "identifier": "GO:0006406",
                "name": "mRNA export from nucleus",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043248",
                "name": "proteasome assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008541",
                "name": "proteasome regulatory particle, lid subcomplex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2a17b97fa67433301596ec453b9a6ac9b1343f79",
        "counters": {
            "domain_architectures": 3954,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3954
        }
    }
}