"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7QKW9"	"{'domain_architectures': 3954, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cdd': 1, 'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3954}"	"['Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins']"	"8042785"	"[{'identifier': 'GO:0006406', 'name': 'mRNA export from nucleus', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0043248', 'name': 'proteasome assembly', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008541', 'name': 'proteasome regulatory particle, lid subcomplex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B7QKW9_IXOSC"	"2a17b97fa67433301596ec453b9a6ac9b1343f79"	True	False	False	79	"26S proteasome complex subunit SEM1"	1	"UP000001555"	"MADPNAKGKVDLGLLEEDDEFEEFPAEEWTAKGEDAQDINVWEDNWDDDNIEDDFSQQLRAELEKQGYKIDGTGEPIKS"	"unreviewed"	"{'taxId': '6945', 'scientificName': 'Ixodes scapularis', 'fullName': 'Ixodes scapularis (Black-legged tick)'}"