HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7MIM1",
"id": "ISCR_ECO45",
"source_organism": {
"taxId": "585035",
"scientificName": "Escherichia coli O45:K1 (strain S88 / ExPEC)",
"fullName": "Escherichia coli O45:K1 (strain S88 / ExPEC)"
},
"name": "HTH-type transcriptional regulator IscR",
"description": [
"Regulates the transcription of several operons and genes involved in the biogenesis of Fe-S clusters and Fe-S-containing proteins"
],
"length": 162,
"sequence": "MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESVDATRCQGKGGCQGGDKCLTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHTHDAPRTRTQDAIDVKLRA",
"proteome": "UP000000747",
"gene": "iscR",
"go_terms": [
{
"identifier": "GO:0003690",
"name": "double-stranded DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d20b5da967e3113f37f77c82f819d9dc52775877",
"counters": {
"domain_architectures": 52043,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 3,
"panther": 1,
"hamap": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 52043
}
}
}