"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7MIM1"	"{'domain_architectures': 52043, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 3, 'panther': 1, 'hamap': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 52043}"	"['Regulates the transcription of several operons and genes involved in the biogenesis of Fe-S clusters and Fe-S-containing proteins']"	"iscR"	"[{'identifier': 'GO:0003690', 'name': 'double-stranded DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"ISCR_ECO45"	"d20b5da967e3113f37f77c82f819d9dc52775877"	True	False	False	162	"HTH-type transcriptional regulator IscR"	3	"UP000000747"	"MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDESVDATRCQGKGGCQGGDKCLTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHTHDAPRTRTQDAIDVKLRA"	"reviewed"	"{'taxId': '585035', 'scientificName': 'Escherichia coli O45:K1 (strain S88 / ExPEC)', 'fullName': 'Escherichia coli O45:K1 (strain S88 / ExPEC)'}"