GET /api/protein/UniProt/B7L423/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7L423",
        "id": "ECPB_ECO55",
        "source_organism": {
            "taxId": "585055",
            "scientificName": "Escherichia coli (strain 55989 / EAEC)",
            "fullName": "Escherichia coli (strain 55989 / EAEC)"
        },
        "name": "Probable fimbrial chaperone EcpB",
        "description": [
            "Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition (By similarity)"
        ],
        "length": 222,
        "sequence": "MKKHLLPLALLFSGISPAQALDVGDISSFMNSDSSTLSKTIKNSTDSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEKERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGSLTNTGNATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK",
        "proteome": "UP000000746",
        "gene": "ecpB",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1480668ca9694e6cc92bff5ae273a8e6dfb50875",
        "counters": {
            "domain_architectures": 402,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 402
        }
    }
}