"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7L423"	"{'domain_architectures': 402, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 402}"	"['Part of the ecpRABCDE operon, which encodes the E.coli common pilus (ECP). ECP is found in both commensal and pathogenic strains and plays a dual role in early-stage biofilm development and host cell recognition (By similarity)']"	"ecpB"	""	"ECPB_ECO55"	"1480668ca9694e6cc92bff5ae273a8e6dfb50875"	True	False	False	222	"Probable fimbrial chaperone EcpB"	3	"UP000000746"	"MKKHLLPLALLFSGISPAQALDVGDISSFMNSDSSTLSKTIKNSTDSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEKERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGSLTNTGNATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK"	"reviewed"	"{'taxId': '585055', 'scientificName': 'Escherichia coli (strain 55989 / EAEC)', 'fullName': 'Escherichia coli (strain 55989 / EAEC)'}"