GET /api/protein/UniProt/B7J3S6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7J3S6",
"id": "B7J3S6_ACIF2",
"source_organism": {
"taxId": "243159",
"scientificName": "Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)",
"fullName": "Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)"
},
"name": "Peptidyl-prolyl cis-trans isomerase",
"description": [
"Also involved in hydrogenase metallocenter assembly, probably by participating in the nickel insertion step. This function in hydrogenase biosynthesis requires chaperone activity and the presence of the metal-binding domain, but not PPIase activity"
],
"length": 162,
"sequence": "MIISKDKVVTIDYSLTDEEGELIDSSVGEEPLVYLHGHHGVIPGLEQALAGRRVGDRLEVSIPPEEGYGDWDEDLVEVVGAEDFDDAEELEIGTQFETMTEDGTRLATIIDIEGDEITVDLNHPLAGMTLNFDVTVLEVRDATAEELAHGHVHGHGEHDEGH",
"proteome": "UP000001362",
"gene": "AFE_0180",
"go_terms": [
{
"identifier": "GO:0003755",
"name": "peptidyl-prolyl cis-trans isomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "597ff609af148c6a7b237ac50dda1c5478f47b0c",
"counters": {
"domain_architectures": 62513,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 62513
}
}
}