"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7J3S6"	"{'domain_architectures': 62513, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 62513}"	"['Also involved in hydrogenase metallocenter assembly, probably by participating in the nickel insertion step. This function in hydrogenase biosynthesis requires chaperone activity and the presence of the metal-binding domain, but not PPIase activity']"	"AFE_0180"	"[{'identifier': 'GO:0003755', 'name': 'peptidyl-prolyl cis-trans isomerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B7J3S6_ACIF2"	"597ff609af148c6a7b237ac50dda1c5478f47b0c"	True	False	False	162	"Peptidyl-prolyl cis-trans isomerase"	3	"UP000001362"	"MIISKDKVVTIDYSLTDEEGELIDSSVGEEPLVYLHGHHGVIPGLEQALAGRRVGDRLEVSIPPEEGYGDWDEDLVEVVGAEDFDDAEELEIGTQFETMTEDGTRLATIIDIEGDEITVDLNHPLAGMTLNFDVTVLEVRDATAEELAHGHVHGHGEHDEGH"	"unreviewed"	"{'taxId': '243159', 'scientificName': 'Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)', 'fullName': 'Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)'}"