General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7IME1",
        "id": "B7IME1_BACC2",
        "source_organism": {
            "taxId": "405531",
            "scientificName": "Bacillus cereus (strain G9842)",
            "fullName": "Bacillus cereus (strain G9842)"
        },
        "name": "Small, acid-soluble spore protein, alpha/beta family",
        "description": [
            "SASP are bound to spore DNA. They are double-stranded DNA-binding proteins that cause DNA to change to an a-like conformation. They protect the DNA backbone from chemical and enzymatic cleavage and are thus involved in dormant spore's high resistance to UV light"
        ],
        "length": 61,
        "sequence": "MVKTNKLLVPGAEQALEQFKYEIAQEFGVSLGSNTASRSNGSVGGEVTKRLVALAQQQLRG",
        "proteome": null,
        "gene": "BCG9842_B3981",
        "go_terms": [
            {
                "identifier": "GO:0003690",
                "name": "double-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006265",
                "name": "DNA topological change",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fdca442fdbb27ca2c29f639496b5d8371e83e1d3",
        "counters": {
            "domain_architectures": 10417,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 10417
        }
    }
}